PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g56520.1.p
Common NameBRADI_2g56520, LOC100838163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 268aa    MW: 28737.6 Da    PI: 9.0211
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g56520.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+  +k +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi2g56520.1.p 14 KGAWTKEEDQRLIAHIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding53.74.9e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T ++del+++++ +lG++ W++Ia  ++ gRt++++k++w+++
  Bradi2g56520.1.p  67 RGNFTDDDDELIIKLHSLLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.693961IPR017930Myb domain
SuperFamilySSF466898.24E-2913108IPR009057Homeodomain-like
SMARTSM007179.8E-141363IPR001005SANT/Myb domain
PfamPF002495.8E-151461IPR001005SANT/Myb domain
CDDcd001677.47E-121661No hitNo description
PROSITE profilePS5129427.47362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2765116IPR009057Homeodomain-like
SMARTSM007176.6E-1666114IPR001005SANT/Myb domain
PfamPF002495.8E-1567111IPR001005SANT/Myb domain
CDDcd001673.60E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAHIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY  60
LRPDLKRGNF TDDDDELIIK LHSLLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLSRG  120
MDPQTHRPIS AAAAAAFPSS SPAPAASRLA GAAFSVVPAS AGFAGPSPPS SDDGHSSSGG  180
SSDGGPRCPD LNLDLDLDLS MGLPPPKTPA VVSSTLTSHP HPQQRQSICL CYHLGVRNGE  240
ACACKTASPA GPRAFRYIRP LEEGQYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519111e-179JF951911.1 Triticum aestivum clone TaMYB28 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564745.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-92MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP15e-92MYB4_ARATH; Transcription repressor MYB4
TrEMBLI1HTV80.0I1HTV8_BRADI; Uncharacterized protein
STRINGBRADI2G56520.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-86myb domain protein 4